| Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.1: Mitochondrial cytochrome c oxidase subunit IV [81406] (1 family) ![]() automatically mapped to Pfam PF02936 |
| Family f.23.1.1: Mitochondrial cytochrome c oxidase subunit IV [81405] (2 proteins) |
| Protein Mitochondrial cytochrome c oxidase subunit IV [81404] (1 species) function unknown, probably acts as a regulator or is required for the assembly |
| Species Cow (Bos taurus) [TaxId:9913] [81403] (32 PDB entries) |
| Domain d1ocrd_: 1ocr D: [43541] Other proteins in same PDB: d1ocra_, d1ocrb1, d1ocrb2, d1ocrc_, d1ocre_, d1ocrf_, d1ocrg_, d1ocrh_, d1ocri_, d1ocrj_, d1ocrk_, d1ocrl_, d1ocrm_, d1ocrn_, d1ocro1, d1ocro2, d1ocrp_, d1ocrr_, d1ocrs_, d1ocrt_, d1ocru_, d1ocrv_, d1ocrw_, d1ocrx_, d1ocry_, d1ocrz_ complexed with cu, hea, mg, na, zn |
PDB Entry: 1ocr (more details), 2.35 Å
SCOPe Domain Sequences for d1ocrd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ocrd_ f.23.1.1 (D:) Mitochondrial cytochrome c oxidase subunit IV {Cow (Bos taurus) [TaxId: 9913]}
svvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvelyrlk
fkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqtkrm
ldmkvapiqgfsakwdydknewkk
Timeline for d1ocrd_:
View in 3DDomains from other chains: (mouse over for more information) d1ocra_, d1ocrb1, d1ocrb2, d1ocrc_, d1ocre_, d1ocrf_, d1ocrg_, d1ocrh_, d1ocri_, d1ocrj_, d1ocrk_, d1ocrl_, d1ocrm_, d1ocrn_, d1ocro1, d1ocro2, d1ocrp_, d1ocrq_, d1ocrr_, d1ocrs_, d1ocrt_, d1ocru_, d1ocrv_, d1ocrw_, d1ocrx_, d1ocry_, d1ocrz_ |