Class f: Membrane and cell surface proteins and peptides [56835] (50 folds) |
Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily) core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest |
Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (1 family) |
Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins) function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel |
Protein Mitochondrial cytochrome c oxidase, subunit III [81445] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [81444] (14 PDB entries) |
Domain d1ocrc_: 1ocr C: [43540] Other proteins in same PDB: d1ocra_, d1ocrb1, d1ocrb2, d1ocrd_, d1ocre_, d1ocrf_, d1ocrg_, d1ocrh_, d1ocri_, d1ocrj_, d1ocrk_, d1ocrl_, d1ocrm_, d1ocrn_, d1ocro1, d1ocro2, d1ocrq_, d1ocrr_, d1ocrs_, d1ocrt_, d1ocru_, d1ocrv_, d1ocrw_, d1ocrx_, d1ocry_, d1ocrz_ |
PDB Entry: 1ocr (more details), 2.35 Å
SCOP Domain Sequences for d1ocrc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ocrc_ f.25.1.1 (C:) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus) [TaxId: 9913]} mthqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrd virestfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptg ihplnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqase yyeapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeagaw ywhfvdvvwlflyvsiywwgs
Timeline for d1ocrc_:
View in 3D Domains from other chains: (mouse over for more information) d1ocra_, d1ocrb1, d1ocrb2, d1ocrd_, d1ocre_, d1ocrf_, d1ocrg_, d1ocrh_, d1ocri_, d1ocrj_, d1ocrk_, d1ocrl_, d1ocrm_, d1ocrn_, d1ocro1, d1ocro2, d1ocrp_, d1ocrq_, d1ocrr_, d1ocrs_, d1ocrt_, d1ocru_, d1ocrv_, d1ocrw_, d1ocrx_, d1ocry_, d1ocrz_ |