Lineage for d2occy1 (2occ Y:)

  1. Root: SCOP 1.55
  2. 38777Class f: Membrane and cell surface proteins and peptides [56835] (11 folds)
  3. 38834Fold f.2: Membrane all-alpha [56868] (1 superfamily)
  4. 38835Superfamily f.2.1: Membrane all-alpha [56869] (10 families) (S)
  5. 38965Family f.2.1.3: Cytochrome c oxidase-like [56883] (2 proteins)
  6. 38966Protein Cytochrome c oxidase [56884] (3 species)
  7. 38967Species Cow (Bos taurus) [TaxId:9913] [56885] (5 PDB entries)
  8. 38986Domain d2occy1: 2occ Y: [43536]
    Other proteins in same PDB: d2occb1, d2occe_, d2occf_, d2occh_, d2occo1, d2occr_, d2occs_, d2occu_

Details for d2occy1

PDB Entry: 2occ (more details), 2.3 Å

PDB Description: bovine heart cytochrome c oxidase at the fully oxidized state

SCOP Domain Sequences for d2occy1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2occy1 f.2.1.3 (Y:) Cytochrome c oxidase {Cow (Bos taurus)}
shyeegpgknipfsvenkwrllammtlffgsgfaapffivrhqllkk

SCOP Domain Coordinates for d2occy1:

Click to download the PDB-style file with coordinates for d2occy1.
(The format of our PDB-style files is described here.)

Timeline for d2occy1: