Class f: Membrane and cell surface proteins and peptides [56835] (36 folds) |
Fold f.23: Single transmembrane helix [81407] (22 superfamilies) not a true fold |
Superfamily f.23.1: Mitochondrial cytochrome c oxidase subunit IV [81406] (1 family) |
Family f.23.1.1: Mitochondrial cytochrome c oxidase subunit IV [81405] (1 protein) |
Protein Mitochondrial cytochrome c oxidase subunit IV [81404] (1 species) function unknown, probably acts as a regulator or is required for the assembly |
Species Cow (Bos taurus) [TaxId:9913] [81403] (5 PDB entries) |
Domain d2occd_: 2occ D: [43521] Other proteins in same PDB: d2occa_, d2occb1, d2occb2, d2occc_, d2occe_, d2occf_, d2occg_, d2occh_, d2occi_, d2occj_, d2occk_, d2occl_, d2occm_, d2occn_, d2occo1, d2occo2, d2occp_, d2occr_, d2occs_, d2occt_, d2occu_, d2occv_, d2occw_, d2occx_, d2occy_, d2occz_ |
PDB Entry: 2occ (more details), 2.3 Å
SCOP Domain Sequences for d2occd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2occd_ f.23.1.1 (D:) Mitochondrial cytochrome c oxidase subunit IV {Cow (Bos taurus)} svvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvelyrlk fkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqtkrm ldmkvapiqgfsakwdydknewkk
Timeline for d2occd_:
View in 3D Domains from other chains: (mouse over for more information) d2occa_, d2occb1, d2occb2, d2occc_, d2occe_, d2occf_, d2occg_, d2occh_, d2occi_, d2occj_, d2occk_, d2occl_, d2occm_, d2occn_, d2occo1, d2occo2, d2occp_, d2occq_, d2occr_, d2occs_, d2occt_, d2occu_, d2occv_, d2occw_, d2occx_, d2occy_, d2occz_ |