SCOPe 2.06: Domain d1eysh2: 1eys H:7-43

Lineage for d1eysh2 (1eys H:7-43)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.10: Photosystem II reaction centre subunit H, transmembrane region [81490] (2 families)

5. Family f.23.10.1: Photosystem II reaction centre subunit H, transmembrane region [81489] (1 protein)

6. Protein Photosystem II reaction centre subunit H, transmembrane region [81488] (4 species)

7. Species Thermochromatium tepidum [TaxId:1050] [81487] (1 PDB entry)

8. Domain d1eysh2: 1eys H:7-43 [43517]
   Other proteins in same PDB: d1eysc_, d1eysh1, d1eysl_, d1eysm_
   complexed with bcl, bgl, bph, crt, fe, hem, lda, mq8, pef

Details for d1eysh2

PDB Entry: 1eys, 2.2 Å

PDB Description: crystal structure of photosynthetic reaction center from a thermophilic bacterium, thermochromatium tepidum

PDB Compounds: (H:) photosynthetic reaction center

SCOPe Domain Sequences for d1eysh2:

Sequence; same for both SEQRES and ATOM records:

>d1eysh2 f.23.10.1 (H:7-43) Photosystem II reaction centre subunit H, transmembrane region {Thermochromatium tepidum [TaxId: 1050]}
hyidaaqitiwafwlfffgliiylrredkregyplds

Timeline for d1eysh2:

• d1eysh2 first appeared (with stable ids) in SCOP 1.55
  
• d1eysh2 appears in SCOPe 2.05
  
• d1eysh2 appears in SCOPe 2.07
  
• d1eysh2 appears in the current release, SCOPe 2.08