![]() | Class f: Membrane and cell surface proteins and peptides [56835] (12 folds) |
![]() | Fold f.2: Membrane all-alpha [56868] (1 superfamily) |
![]() | Superfamily f.2.1: Membrane all-alpha [56869] (13 families) ![]() |
![]() | Family f.2.1.2: Photosynthetic reaction centre, L-, M- and H-chains [56878] (1 protein) |
![]() | Protein Photosynthetic reaction centre, L-, M- and H-chains [56879] (3 species) |
![]() | Species Thermochromatium tepidum [TaxId:1050] [56882] (1 PDB entry) |
![]() | Domain d1eysh2: 1eys H:7-43 [43517] Other proteins in same PDB: d1eysc_, d1eysh1 |
PDB Entry: 1eys (more details), 2.2 Å
SCOP Domain Sequences for d1eysh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eysh2 f.2.1.2 (H:7-43) Photosynthetic reaction centre, L-, M- and H-chains {Thermochromatium tepidum} hyidaaqitiwafwlfffgliiylrredkregyplds
Timeline for d1eysh2: