Structural Classification of Proteins and ASTRAL release 1.75 (June 2009)
Search SCOP (example):

Lineage for d1eysm_ (1eys M:)

  1. Root: SCOP 1.75
  2. Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
  5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (4 protein domains)
    L and M are probably related to each other
  6. Protein M (medium) subunit [81481] (3 species)
  7. Species Thermochromatium tepidum [TaxId:1050] [81480] (1 PDB entry)
  8. Domain d1eysm_: 1eys M: [43516]
    Other proteins in same PDB: d1eysc_, d1eysh1, d1eysh2, d1eysl_
    complexed with bcl, bgl, bph, crt, fe, hem, lda, mq8, pef

Details for d1eysm_

PDB Entry: 1eys (more details)
PDB Description: crystal structure of photosynthetic reaction center from a thermophilic bacterium, thermochromatium tepidum
PDB Compounds: (M:) photosynthetic reaction center

SCOP Domain Sequences for d1eysm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eysm_ f.26.1.1 (M:) M (medium) subunit {Thermochromatium tepidum [TaxId: 1050]}
peyqniftavqvrapaypgvplpkgnlprigrpifsywlgkigdaqigpiylgltgtlsi
ffglvaisiigfnmlasvhwdvfqflkhffwlgleppppqyglripplseggwwliaglf
ltlsillwwvrtykraealgmsqhlswafaaaiffylvlgfirpvmmgswakavpfgifp
hldwtaafsirygnlyynpfhmlsiaflygsallfamhgatilsvsrfggdreidqithr
gtaaegaalfwrwtmgfnatmesihrwawwcavltvitagigillsgtvvdnwylwavkh
gmapaypevvtavnpyet

SCOP Domain Coordinates for d1eysm_:

Click to download the PDB-style file with coordinates for d1eysm_.
(The format of our PDB-style files is described here.)

Timeline for d1eysm_:

d1eysm_ appears in SCOP 1.73
d1eysm_ appears in SCOP 1.75A


d1eysm_
(click for larger image)


d1eysm_ in context of chain



d1eysm_ in context of PDB
Domains from other chains:
d1eysc_, d1eysh1, d1eysh2, d1eysl_

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu