![]() | Class f: Membrane and cell surface proteins and peptides [56835] (42 folds) |
![]() | Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
![]() | Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) ![]() |
![]() | Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (2 proteins) L and M are probably related to each other |
![]() | Protein L (light) subunit [81477] (3 species) |
![]() | Species Thermochromatium tepidum [TaxId:1050] [81476] (1 PDB entry) |
![]() | Domain d1eysl_: 1eys L: [43515] Other proteins in same PDB: d1eysc_, d1eysh1, d1eysh2, d1eysm_ complexed with bcl, bgl, bph, crt, fe, hem, lda, mq8, pef |
PDB Entry: 1eys (more details), 2.2 Å
SCOP Domain Sequences for d1eysl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eysl_ f.26.1.1 (L:) L (light) subunit {Thermochromatium tepidum} amlsfekkyrvrggtliggdlfdfwvgpfyvgffgvvgfcftllgvllivwgatigptgp tsdlqtynlwrisiappdlsyglrmapltegglwqiiticaagafiswalreveicrklg igfhvpfafsfaigaylvlvfvrpllmgawghgfpygilshldwvsnvgyqflhfhynpa hmlaisffftnclalsmhgslilsvtnpqrgepvktsehentffrdivgysigalaihrl glflalsaafwsavcilisgpfwtrgwpewwnwwlelplw
Timeline for d1eysl_:
![]() Domains from other chains: (mouse over for more information) d1eysc_, d1eysh1, d1eysh2, d1eysm_ |