Lineage for d4rcrm1 (4rcr M:)

  1. Root: SCOP 1.59
  2. 141686Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)
  3. 141752Fold f.2: Membrane all-alpha [56868] (1 superfamily)
  4. 141753Superfamily f.2.1: Membrane all-alpha [56869] (11 families) (S)
  5. 141805Family f.2.1.2: Photosynthetic reaction centre, L-, M- and H-chains [56878] (1 protein)
  6. 141806Protein Photosynthetic reaction centre, L-, M- and H-chains [56879] (3 species)
  7. 141807Species Rhodobacter sphaeroides [TaxId:1063] [56881] (23 PDB entries)
  8. 141891Domain d4rcrm1: 4rcr M: [43513]
    Other proteins in same PDB: d4rcrh1

Details for d4rcrm1

PDB Entry: 4rcr (more details), 2.8 Å

PDB Description: structure of the reaction center from rhodobacter sphaeroides r-26 and 2.4.1: protein-cofactor (bacteriochlorophyll, bacteriopheophytin, and carotenoid) interactions

SCOP Domain Sequences for d4rcrm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rcrm1 f.2.1.2 (M:) Photosynthetic reaction centre, L-, M- and H-chains {Rhodobacter sphaeroides}
ifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlslfsglm
wfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasffmfva
vwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygifshldw
tnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiadrgtaa
eraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqnh

SCOP Domain Coordinates for d4rcrm1:

Click to download the PDB-style file with coordinates for d4rcrm1.
(The format of our PDB-style files is described here.)

Timeline for d4rcrm1: