SCOP 1.63: Domain d1ysth2: 1yst H:1-35

Lineage for d1ysth2 (1yst H:1-35)

1. Root: SCOP 1.63

2. Class f: Membrane and cell surface proteins and peptides [56835] (34 folds)

3. Fold f.23: Single transmembrane helix [81407] (22 superfamilies)
   not a true fold

4. Superfamily f.23.10: Photosystem II reaction centre subunit H, transmembrane region [81490] (1 family)

5. Family f.23.10.1: Photosystem II reaction centre subunit H, transmembrane region [81489] (1 protein)

6. Protein Photosystem II reaction centre subunit H, transmembrane region [81488] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81486] (29 PDB entries)

8. Domain d1ysth2: 1yst H:1-35 [43511]
   Other proteins in same PDB: d1ysth1, d1ystl_, d1ystm_
   complexed with bcl, bph, mn, spo, u10

Details for d1ysth2

PDB Entry: 1yst, 3 Å

PDB Description: structure of the photochemical reaction center of a spheroidene containing purple bacterium, rhodobacter sphaeroides y, at 3 angstroms resolution

SCOP Domain Sequences for d1ysth2:

Sequence; same for both SEQRES and ATOM records:

>d1ysth2 f.23.10.1 (H:1-35) Photosystem II reaction centre subunit H, transmembrane region {Rhodobacter sphaeroides}
mvgvtafgnfdlaslaiysfwiflagliyylqten

Timeline for d1ysth2:

• d1ysth2 first appeared (with stable ids) in SCOP 1.55
  
• d1ysth2 appears in SCOP 1.61
  
• d1ysth2 appears in SCOP 1.65
  
• d1ysth2 appears in the current release, SCOPe 2.08