Lineage for d1ysth2 (1yst H:1-35)

  1. Root: SCOP 1.63
  2. 267451Class f: Membrane and cell surface proteins and peptides [56835] (34 folds)
  3. 268041Fold f.23: Single transmembrane helix [81407] (22 superfamilies)
    not a true fold
  4. 268155Superfamily f.23.10: Photosystem II reaction centre subunit H, transmembrane region [81490] (1 family) (S)
  5. 268156Family f.23.10.1: Photosystem II reaction centre subunit H, transmembrane region [81489] (1 protein)
  6. 268157Protein Photosystem II reaction centre subunit H, transmembrane region [81488] (3 species)
  7. 268158Species Rhodobacter sphaeroides [TaxId:1063] [81486] (29 PDB entries)
  8. 268192Domain d1ysth2: 1yst H:1-35 [43511]
    Other proteins in same PDB: d1ysth1, d1ystl_, d1ystm_
    complexed with bcl, bph, mn, spo, u10

Details for d1ysth2

PDB Entry: 1yst (more details), 3 Å

PDB Description: structure of the photochemical reaction center of a spheroidene containing purple bacterium, rhodobacter sphaeroides y, at 3 angstroms resolution

SCOP Domain Sequences for d1ysth2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ysth2 f.23.10.1 (H:1-35) Photosystem II reaction centre subunit H, transmembrane region {Rhodobacter sphaeroides}
mvgvtafgnfdlaslaiysfwiflagliyylqten

SCOP Domain Coordinates for d1ysth2:

Click to download the PDB-style file with coordinates for d1ysth2.
(The format of our PDB-style files is described here.)

Timeline for d1ysth2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ysth1