SCOPe 2.03: Domain d1ystl_: 1yst L:

Lineage for d1ystl_ (1yst L:)

1. Root: SCOPe 2.03

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein L (light) subunit [81477] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81475] (56 PDB entries)
   Uniprot P02954

8. Domain d1ystl_: 1yst L: [43509]
   Other proteins in same PDB: d1ysth1, d1ysth2, d1ystm_
   complexed with bcl, bph, mn, spo, u10

Details for d1ystl_

PDB Entry: 1yst, 3 Å

PDB Description: structure of the photochemical reaction center of a spheroidene containing purple bacterium, rhodobacter sphaeroides y, at 3 angstroms resolution

PDB Compounds: (L:) photosynthetic reaction center (l subunit)

SCOPe Domain Sequences for d1ystl_:

Sequence; same for both SEQRES and ATOM records:

>d1ystl_ f.26.1.1 (L:) L (light) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwa

Timeline for d1ystl_:

• d1ystl_ first appeared (with stable ids) in SCOP 1.55, called d1ystl1
  
• d1ystl_ appears in SCOPe 2.02
  
• d1ystl_ appears in SCOPe 2.04
  
• d1ystl_ appears in the current release, SCOPe 2.08