![]() | Class f: Membrane and cell surface proteins and peptides [56835] (58 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
![]() | Superfamily f.23.10: Photosystem II reaction centre subunit H, transmembrane region [81490] (1 family) ![]() |
![]() | Family f.23.10.1: Photosystem II reaction centre subunit H, transmembrane region [81489] (1 protein) |
![]() | Protein Photosystem II reaction centre subunit H, transmembrane region [81488] (3 species) |
![]() | Species Rhodobacter sphaeroides [TaxId:1063] [81486] (39 PDB entries) Uniprot P11846 |
![]() | Domain d2rcrh2: 2rcr H:1-35 [43508] Other proteins in same PDB: d2rcrh1, d2rcrl_, d2rcrm_ complexed with bcl, bpa, fe, uq |
PDB Entry: 2rcr (more details), 3.1 Å
SCOP Domain Sequences for d2rcrh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rcrh2 f.23.10.1 (H:1-35) Photosystem II reaction centre subunit H, transmembrane region {Rhodobacter sphaeroides [TaxId: 1063]} mvgvtafgnfdlaslaiysfwiflagliyylqten
Timeline for d2rcrh2: