SCOP 1.73: Domain d2rcrm_: 2rcr M:

Lineage for d2rcrm_ (2rcr M:)

1. Root: SCOP 1.73

2. Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (2 proteins)
   L and M are probably related to each other

6. Protein M (medium) subunit [81481] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81479] (50 PDB entries)

8. Domain d2rcrm_: 2rcr M: [43507]
   Other proteins in same PDB: d2rcrh1, d2rcrh2, d2rcrl_
   complexed with bcl, bpa, fe, uq

Details for d2rcrm_

PDB Entry: 2rcr, 3.1 Å

PDB Description: structure of the membrane-bound protein photosynthetic reaction center from rhodobacter sphaeroides

PDB Compounds: (M:) photosynthetic reaction center (m subunit)

SCOP Domain Sequences for d2rcrm_:

Sequence; same for both SEQRES and ATOM records:

>d2rcrm_ f.26.1.1 (M:) M (medium) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
hgmap

Timeline for d2rcrm_:

• d2rcrm_ first appeared (with stable ids) in SCOP 1.55, called d2rcrm1
  
• d2rcrm_ appears in SCOP 1.71
  
• d2rcrm_ appears in SCOP 1.75
  
• d2rcrm_ appears in the current release, SCOPe 2.08