SCOP 1.61: Domain d2rcrm1: 2rcr M:

Lineage for d2rcrm1 (2rcr M:)

1. Root: SCOP 1.61

2. Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)

3. Fold f.2: Membrane all-alpha [56868] (1 superfamily)

4. Superfamily f.2.1: Membrane all-alpha [56869] (13 families)

5. Family f.2.1.2: Photosynthetic reaction centre, L-, M- and H-chains [56878] (1 protein)

6. Protein Photosynthetic reaction centre, L-, M- and H-chains [56879] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [56881] (28 PDB entries)

8. Domain d2rcrm1: 2rcr M: [43507]
   Other proteins in same PDB: d2rcrh1

Details for d2rcrm1

PDB Entry: 2rcr, 3.1 Å

PDB Description: structure of the membrane-bound protein photosynthetic reaction center from rhodobacter sphaeroides

SCOP Domain Sequences for d2rcrm1:

Sequence; same for both SEQRES and ATOM records:

>d2rcrm1 f.2.1.2 (M:) Photosynthetic reaction centre, L-, M- and H-chains {Rhodobacter sphaeroides}
aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
hgmap

Timeline for d2rcrm1:

• d2rcrm1 first appeared (with stable ids) in SCOP 1.55
  
• d2rcrm1 appears in SCOP 1.59
  
• d2rcrm1 is called d2rcrm_ in SCOP 1.63
  
• d2rcrm1 appears in the current release, SCOPe 2.08, called d2rcrm_