Lineage for d2rcrm_ (2rcr M:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3027280Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 3027281Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 3027282Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 3027382Protein M (medium) subunit [81481] (4 species)
  7. 3027383Species Rhodobacter sphaeroides [TaxId:1063] [81479] (65 PDB entries)
    Uniprot P02953
  8. 3027451Domain d2rcrm_: 2rcr M: [43507]
    Other proteins in same PDB: d2rcrh1, d2rcrh2, d2rcrl_
    complexed with bcl, bph, fe, uq

Details for d2rcrm_

PDB Entry: 2rcr (more details), 3.1 Å

PDB Description: structure of the membrane-bound protein photosynthetic reaction center from rhodobacter sphaeroides
PDB Compounds: (M:) photosynthetic reaction center (m subunit)

SCOPe Domain Sequences for d2rcrm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rcrm_ f.26.1.1 (M:) M (medium) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
hgmap

SCOPe Domain Coordinates for d2rcrm_:

Click to download the PDB-style file with coordinates for d2rcrm_.
(The format of our PDB-style files is described here.)

Timeline for d2rcrm_: