![]() | Class f: Membrane and cell surface proteins and peptides [56835] (50 folds) |
![]() | Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
![]() | Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) ![]() |
![]() | Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (2 proteins) L and M are probably related to each other |
![]() | Protein L (light) subunit [81477] (3 species) |
![]() | Species Rhodobacter sphaeroides [TaxId:1063] [81475] (50 PDB entries) |
![]() | Domain d2rcrl_: 2rcr L: [43506] Other proteins in same PDB: d2rcrh1, d2rcrh2, d2rcrm_ complexed with bcl, bpa, fe, uq |
PDB Entry: 2rcr (more details), 3.1 Å
SCOP Domain Sequences for d2rcrl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rcrl_ f.26.1.1 (L:) L (light) subunit {Rhodobacter sphaeroides [TaxId: 1063]} allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgg
Timeline for d2rcrl_: