SCOP 1.63: Domain d1pssm_: 1pss M:

Lineage for d1pssm_ (1pss M:)

1. Root: SCOP 1.63

2. Class f: Membrane and cell surface proteins and peptides [56835] (34 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (2 proteins)
   L and M are probably related to each other

6. Protein M (medium) subunit [81481] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81479] (29 PDB entries)

8. Domain d1pssm_: 1pss M: [43501]
   Other proteins in same PDB: d1pssh1, d1pssh2, d1pssl_
   complexed with bcl, bph, crt, fe, u10

Details for d1pssm_

PDB Entry: 1pss, 3 Å

PDB Description: crystallographic analyses of site-directed mutants of the photosynthetic reaction center from rhodobacter sphaeroides

SCOP Domain Sequences for d1pssm_:

Sequence; same for both SEQRES and ATOM records:

>d1pssm_ f.26.1.1 (M:) M (medium) subunit {Rhodobacter sphaeroides}
ifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlslfsglm
wfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasffmfva
vwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygifshldw
tnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiadrgtaa
eraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqnh

Timeline for d1pssm_:

• d1pssm_ first appeared (with stable ids) in SCOP 1.55, called d1pssm1
  
• d1pssm_ was called d1pssm1 in SCOP 1.61
  
• d1pssm_ appears in SCOP 1.65
  
• d1pssm_ appears in the current release, SCOPe 2.08