SCOP 1.55: Domain d1pssm1: 1pss M:

Lineage for d1pssm1 (1pss M:)

1. Root: SCOP 1.55

2. Class f: Membrane and cell surface proteins and peptides [56835] (11 folds)

3. Fold f.2: Membrane all-alpha [56868] (1 superfamily)

4. Superfamily f.2.1: Membrane all-alpha [56869] (10 families)

5. Family f.2.1.2: Photosynthetic reaction centre, L-, M- and H-chains [56878] (1 protein)

6. Protein Photosynthetic reaction centre, L-, M- and H-chains [56879] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [56881] (15 PDB entries)

8. Domain d1pssm1: 1pss M: [43501]
   Other proteins in same PDB: d1pssh1

Details for d1pssm1

PDB Entry: 1pss, 3 Å

PDB Description: crystallographic analyses of site-directed mutants of the photosynthetic reaction center from rhodobacter sphaeroides

SCOP Domain Sequences for d1pssm1:

Sequence; same for both SEQRES and ATOM records:

>d1pssm1 f.2.1.2 (M:) Photosynthetic reaction centre, L-, M- and H-chains {Rhodobacter sphaeroides}
ifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlslfsglm
wfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasffmfva
vwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygifshldw
tnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiadrgtaa
eraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqnh

Timeline for d1pssm1:

• d1pssm1 appears in SCOP 1.57
  
• d1pssm1 appears in the current release, SCOPe 2.08, called d1pssm_