Class f: Membrane and cell surface proteins and peptides [56835] (12 folds) |
Fold f.2: Membrane all-alpha [56868] (1 superfamily) |
Superfamily f.2.1: Membrane all-alpha [56869] (13 families) |
Family f.2.1.2: Photosynthetic reaction centre, L-, M- and H-chains [56878] (1 protein) |
Protein Photosynthetic reaction centre, L-, M- and H-chains [56879] (3 species) |
Species Rhodobacter sphaeroides [TaxId:1063] [56881] (28 PDB entries) |
Domain d1pssl1: 1pss L: [43500] Other proteins in same PDB: d1pssh1 |
PDB Entry: 1pss (more details), 3 Å
SCOP Domain Sequences for d1pssl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pssl1 f.2.1.2 (L:) Photosynthetic reaction centre, L-, M- and H-chains {Rhodobacter sphaeroides} ferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwnpqli svyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfafafa ilayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisffftna lalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsavffs alcmiitgtiwfdqwvdwwqwwvklp
Timeline for d1pssl1: