SCOP 1.63: Domain d1e14l_: 1e14 L:

Lineage for d1e14l_ (1e14 L:)

1. Root: SCOP 1.63

2. Class f: Membrane and cell surface proteins and peptides [56835] (34 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (2 proteins)
   L and M are probably related to each other

6. Protein L (light) subunit [81477] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81475] (29 PDB entries)

8. Domain d1e14l_: 1e14 L: [43497]
   Other proteins in same PDB: d1e14h1, d1e14h2, d1e14m_
   complexed with bcl, bph, cdl, fe, lda, spn, u10; mutant

Details for d1e14l_

PDB Entry: 1e14, 2.7 Å

PDB Description: photosynthetic reaction center mutant with phe m197 replaced with arg (chain m, fm197r) and gly m203 replaced with asp (chain m, gm203d)

SCOP Domain Sequences for d1e14l_:

Sequence; same for both SEQRES and ATOM records:

>d1e14l_ f.26.1.1 (L:) L (light) subunit {Rhodobacter sphaeroides}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

Timeline for d1e14l_:

• d1e14l_ first appeared (with stable ids) in SCOP 1.55, called d1e14l1
  
• d1e14l_ was called d1e14l1 in SCOP 1.61
  
• d1e14l_ appears in SCOP 1.65
  
• d1e14l_ appears in the current release, SCOPe 2.08