SCOPe 2.05: Domain d1pcrm_: 1pcr M:

Lineage for d1pcrm_ (1pcr M:)

1. Root: SCOPe 2.05

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein M (medium) subunit [81481] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81479] (60 PDB entries)
   Uniprot P02953

8. Domain d1pcrm_: 1pcr M: [43495]
   Other proteins in same PDB: d1pcrh1, d1pcrh2, d1pcrl_
   complexed with bcl, bph, fe, lda, po4, spo, u10

Details for d1pcrm_

PDB Entry: 1pcr, 2.65 Å

PDB Description: structure of the photosynthetic reaction centre from rhodobacter sphaeroides at 2.65 angstroms resolution: cofactors and protein-cofactor interactions

PDB Compounds: (M:) photosynthetic reaction center

SCOPe Domain Sequences for d1pcrm_:

Sequence; same for both SEQRES and ATOM records:

>d1pcrm_ f.26.1.1 (M:) M (medium) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
hg

Timeline for d1pcrm_:

• d1pcrm_ first appeared (with stable ids) in SCOP 1.55, called d1pcrm1
  
• d1pcrm_ appears in SCOPe 2.04
  
• d1pcrm_ appears in SCOPe 2.06
  
• d1pcrm_ appears in the current release, SCOPe 2.08