Lineage for d1dv6r1 (1dv6 R:)

  1. Root: SCOP 1.55
  2. 38777Class f: Membrane and cell surface proteins and peptides [56835] (11 folds)
  3. 38834Fold f.2: Membrane all-alpha [56868] (1 superfamily)
  4. 38835Superfamily f.2.1: Membrane all-alpha [56869] (10 families) (S)
  5. 38873Family f.2.1.2: Photosynthetic reaction centre, L-, M- and H-chains [56878] (1 protein)
  6. 38874Protein Photosynthetic reaction centre, L-, M- and H-chains [56879] (3 species)
  7. 38875Species Rhodobacter sphaeroides [TaxId:1063] [56881] (15 PDB entries)
  8. 38912Domain d1dv6r1: 1dv6 R: [43491]
    Other proteins in same PDB: d1dv6h1, d1dv6t1

Details for d1dv6r1

PDB Entry: 1dv6 (more details), 2.5 Å

PDB Description: photosynthetic reaction center from rhodobacter sphaeroides in the charge-neutral dqaqb state with the proton transfer inhibitor zn2+

SCOP Domain Sequences for d1dv6r1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dv6r1 f.2.1.2 (R:) Photosynthetic reaction centre, L-, M- and H-chains {Rhodobacter sphaeroides}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

SCOP Domain Coordinates for d1dv6r1:

Click to download the PDB-style file with coordinates for d1dv6r1.
(The format of our PDB-style files is described here.)

Timeline for d1dv6r1: