Lineage for d1dv6m_ (1dv6 M:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1958788Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 1958789Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 1958790Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 1958875Protein M (medium) subunit [81481] (3 species)
  7. 1958876Species Rhodobacter sphaeroides [TaxId:1063] [81479] (60 PDB entries)
    Uniprot P02953
  8. 1958903Domain d1dv6m_: 1dv6 M: [43489]
    Other proteins in same PDB: d1dv6h1, d1dv6h2, d1dv6l_, d1dv6r_, d1dv6t1, d1dv6t2
    complexed with bcl, bph, cl, fe2, lda, u10, zn

Details for d1dv6m_

PDB Entry: 1dv6 (more details), 2.5 Å

PDB Description: photosynthetic reaction center from rhodobacter sphaeroides in the charge-neutral dqaqb state with the proton transfer inhibitor zn2+
PDB Compounds: (M:) photosynthetic reaction center

SCOPe Domain Sequences for d1dv6m_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dv6m_ f.26.1.1 (M:) M (medium) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
yqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlslfs
glmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasffm
fvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygifsh
ldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiadrg
taaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqnh

SCOPe Domain Coordinates for d1dv6m_:

Click to download the PDB-style file with coordinates for d1dv6m_.
(The format of our PDB-style files is described here.)

Timeline for d1dv6m_: