Lineage for d1aigo_ (1aig O:)

  1. Root: SCOP 1.73
  2. 744527Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)
  3. 746204Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 746205Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
  5. 746206Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (2 proteins)
    L and M are probably related to each other
  6. 746280Protein M (medium) subunit [81481] (3 species)
  7. 746281Species Rhodobacter sphaeroides [TaxId:1063] [81479] (50 PDB entries)
  8. 746308Domain d1aigo_: 1aig O: [43486]
    Other proteins in same PDB: d1aigh1, d1aigh2, d1aigl_, d1aign_, d1aigp1, d1aigp2
    complexed with bcl, bph, fe2, u10

Details for d1aigo_

PDB Entry: 1aig (more details), 2.6 Å

PDB Description: photosynthetic reaction center from rhodobacter sphaeroides in the d+qb-charge separated state
PDB Compounds: (O:) photosynthetic reaction center (m subunit)

SCOP Domain Sequences for d1aigo_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aigo_ f.26.1.1 (O:) M (medium) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
yqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlslfs
glmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasffm
fvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygifsh
ldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiadrg
taaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqnh

SCOP Domain Coordinates for d1aigo_:

Click to download the PDB-style file with coordinates for d1aigo_.
(The format of our PDB-style files is described here.)

Timeline for d1aigo_: