Lineage for d1ds8s_ (1ds8 S:)

  1. Root: SCOP 1.65
  2. 340091Class f: Membrane and cell surface proteins and peptides [56835] (36 folds)
  3. 341077Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 341078Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
  5. 341079Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (2 proteins)
    L and M are probably related to each other
  6. 341128Protein M (medium) subunit [81481] (3 species)
  7. 341129Species Rhodobacter sphaeroides [TaxId:1063] [81479] (29 PDB entries)
  8. 341139Domain d1ds8s_: 1ds8 S: [43474]
    Other proteins in same PDB: d1ds8h1, d1ds8h2, d1ds8l_, d1ds8r_, d1ds8t1, d1ds8t2
    complexed with bcl, bph, cd, cl, fe2, lda, u10

Details for d1ds8s_

PDB Entry: 1ds8 (more details), 2.5 Å

PDB Description: photosynthetic reaction center from rhodobacter sphaeroides in the charge-neutral dqaqb state with the proton transfer inhibitor cd2+

SCOP Domain Sequences for d1ds8s_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ds8s_ f.26.1.1 (S:) M (medium) subunit {Rhodobacter sphaeroides}
yqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlslfs
glmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasffm
fvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygifsh
ldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiadrg
taaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqnh

SCOP Domain Coordinates for d1ds8s_:

Click to download the PDB-style file with coordinates for d1ds8s_.
(The format of our PDB-style files is described here.)

Timeline for d1ds8s_: