SCOP 1.61: Domain d1ds8m1: 1ds8 M:

Lineage for d1ds8m1 (1ds8 M:)

1. Root: SCOP 1.61

2. Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)

3. Fold f.2: Membrane all-alpha [56868] (1 superfamily)

4. Superfamily f.2.1: Membrane all-alpha [56869] (13 families)

5. Family f.2.1.2: Photosynthetic reaction centre, L-, M- and H-chains [56878] (1 protein)

6. Protein Photosynthetic reaction centre, L-, M- and H-chains [56879] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [56881] (28 PDB entries)

8. Domain d1ds8m1: 1ds8 M: [43471]
   Other proteins in same PDB: d1ds8h1, d1ds8t1

Details for d1ds8m1

PDB Entry: 1ds8, 2.5 Å

PDB Description: photosynthetic reaction center from rhodobacter sphaeroides in the charge-neutral dqaqb state with the proton transfer inhibitor cd2+

SCOP Domain Sequences for d1ds8m1:

Sequence; same for both SEQRES and ATOM records:

>d1ds8m1 f.2.1.2 (M:) Photosynthetic reaction centre, L-, M- and H-chains {Rhodobacter sphaeroides}
yqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlslfs
glmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasffm
fvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygifsh
ldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiadrg
taaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqnh

Timeline for d1ds8m1:

• d1ds8m1 first appeared (with stable ids) in SCOP 1.55
  
• d1ds8m1 appears in SCOP 1.59
  
• d1ds8m1 is called d1ds8m_ in SCOP 1.63
  
• d1ds8m1 appears in the current release, SCOPe 2.08, called d1ds8m_