Domain d1ds8m_: 1ds8 M:

Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)

Lineage for d1ds8m_ (1ds8 M:)

Root: SCOP 1.75B
Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
five transmembrane helices forming a sheet-like structure
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 protein domains)
L and M are probably related to each other
Protein M (medium) subunit [81481] (3 species)
Species Rhodobacter sphaeroides [TaxId:1063] [81479] (46 PDB entries)
Uniprot P02953
Domain d1ds8m_: 1ds8 M: [43471]
Other proteins in same PDB: d1ds8h1, d1ds8h2, d1ds8l_, d1ds8r_, d1ds8t1, d1ds8t2
complexed with bcl, bph, cd, cl, fe2, lda, u10

Details for d1ds8m_

PDB Entry: 1ds8 (more details)
PDB Description: photosynthetic reaction center from rhodobacter sphaeroides charge-neutral dqaqb state with the proton transfer inhibit
PDB Compounds: (M:) reaction center protein m chain

SCOP Domain Sequences for d1ds8m_:
Sequence; same for both SEQRES and ATOM records: (download)

>d1ds8m_ f.26.1.1 (M:) M (medium) subunit {Rhodobacter sphaeroides [TaxId: 1063]} yqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlslfs glmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasffm fvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygifsh ldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiadrg taaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqnh

SCOP Domain Coordinates for d1ds8m_:

Click to download the PDB-style file with coordinates for d1ds8m_.
(The format of our PDB-style files is described here.)

Timeline for d1ds8m_:
d1ds8m_ appears in SCOP 1.75A

d1ds8m_
(click for larger image)

d1ds8m_ in context of chain

d1ds8m_ in context of PDB
Domains from other chains:
d1ds8h1, d1ds8h2, d1ds8l_, d1ds8r_, d1ds8s_, d1ds8t1, d1ds8t2