SCOP 1.63: Domain d1mpsm_: 1mps M:

Lineage for d1mpsm_ (1mps M:)

1. Root: SCOP 1.63

2. Class f: Membrane and cell surface proteins and peptides [56835] (34 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (2 proteins)
   L and M are probably related to each other

6. Protein M (medium) subunit [81481] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81479] (29 PDB entries)

8. Domain d1mpsm_: 1mps M: [43468]
   Other proteins in same PDB: d1mpsh1, d1mpsh2, d1mpsl_
   complexed with bcl, bph, fe2, lda, po4, spn, u10; mutant

Details for d1mpsm_

PDB Entry: 1mps, 2.55 Å

PDB Description: photosynthetic reaction center mutant with phe m 197 replaced with arg and tyr m 177 replaced with phe (chain m, y177f, f197r)

SCOP Domain Sequences for d1mpsm_:

Sequence; same for both SEQRES and ATOM records:

>d1mpsm_ f.26.1.1 (M:) M (medium) subunit {Rhodobacter sphaeroides}
aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpfgif
shldwtnnfslvhgnlrynpfhglsiaflygsallfamhgatilavsrfggereleqiad
rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
hg

Timeline for d1mpsm_:

• d1mpsm_ first appeared (with stable ids) in SCOP 1.55, called d1mpsm1
  
• d1mpsm_ was called d1mpsm1 in SCOP 1.61
  
• d1mpsm_ appears in SCOP 1.65
  
• d1mpsm_ appears in the current release, SCOPe 2.08