SCOP 1.59: Domain d1mpsm1: 1mps M:

Lineage for d1mpsm1 (1mps M:)

1. Root: SCOP 1.59

2. Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)

3. Fold f.2: Membrane all-alpha [56868] (1 superfamily)

4. Superfamily f.2.1: Membrane all-alpha [56869] (11 families)

5. Family f.2.1.2: Photosynthetic reaction centre, L-, M- and H-chains [56878] (1 protein)

6. Protein Photosynthetic reaction centre, L-, M- and H-chains [56879] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [56881] (23 PDB entries)

8. Domain d1mpsm1: 1mps M: [43468]
   Other proteins in same PDB: d1mpsh1

Details for d1mpsm1

PDB Entry: 1mps, 2.55 Å

PDB Description: photosynthetic reaction center mutant with phe m 197 replaced with arg and tyr m 177 replaced with phe (chain m, y177f, f197r)

SCOP Domain Sequences for d1mpsm1:

Sequence; same for both SEQRES and ATOM records:

>d1mpsm1 f.2.1.2 (M:) Photosynthetic reaction centre, L-, M- and H-chains {Rhodobacter sphaeroides}
aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpfgif
shldwtnnfslvhgnlrynpfhglsiaflygsallfamhgatilavsrfggereleqiad
rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
hg

Timeline for d1mpsm1:

• d1mpsm1 first appeared (with stable ids) in SCOP 1.55
  
• d1mpsm1 appears in SCOP 1.57
  
• d1mpsm1 appears in SCOP 1.61
  
• d1mpsm1 appears in the current release, SCOPe 2.08, called d1mpsm_