Lineage for d1aijs_ (1aij S:)

  1. Root: SCOP 1.63
  2. 267451Class f: Membrane and cell surface proteins and peptides [56835] (34 folds)
  3. 268375Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 268376Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
  5. 268377Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (2 proteins)
    L and M are probably related to each other
  6. 268426Protein M (medium) subunit [81481] (3 species)
  7. 268427Species Rhodobacter sphaeroides [TaxId:1063] [81479] (29 PDB entries)
  8. 268430Domain d1aijs_: 1aij S: [43465]
    Other proteins in same PDB: d1aijh1, d1aijh2, d1aijl_, d1aijr_, d1aijt1, d1aijt2
    complexed with bcl, bph, fe2, lda, u10

Details for d1aijs_

PDB Entry: 1aij (more details), 2.2 Å

PDB Description: photosynthetic reaction center from rhodobacter sphaeroides in the charge-neutral dqaqb state

SCOP Domain Sequences for d1aijs_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aijs_ f.26.1.1 (S:) M (medium) subunit {Rhodobacter sphaeroides}
yqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlslfs
glmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasffm
fvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygifsh
ldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiadrg
taaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqnh

SCOP Domain Coordinates for d1aijs_:

Click to download the PDB-style file with coordinates for d1aijs_.
(The format of our PDB-style files is described here.)

Timeline for d1aijs_: