![]() | Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
![]() | Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
![]() | Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) ![]() automatically mapped to Pfam PF00124 |
![]() | Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins) L and M are probably related to each other |
![]() | Protein L (light) subunit [81477] (3 species) |
![]() | Species Rhodobacter sphaeroides [TaxId:1063] [81475] (62 PDB entries) Uniprot P02954 |
![]() | Domain d1aijr_: 1aij R: [43464] Other proteins in same PDB: d1aijh1, d1aijh2, d1aijm_, d1aijs_, d1aijt1, d1aijt2 complexed with bcl, bph, fe2, lda, u10 |
PDB Entry: 1aij (more details), 2.2 Å
SCOPe Domain Sequences for d1aijr_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aijr_ f.26.1.1 (R:) L (light) subunit {Rhodobacter sphaeroides [TaxId: 1063]} allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging
Timeline for d1aijr_: