Lineage for d1aijr_ (1aij R:)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1457799Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 1457800Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 1457801Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 1457802Protein L (light) subunit [81477] (3 species)
  7. 1457803Species Rhodobacter sphaeroides [TaxId:1063] [81475] (56 PDB entries)
    Uniprot P02954
  8. 1457812Domain d1aijr_: 1aij R: [43464]
    Other proteins in same PDB: d1aijh1, d1aijh2, d1aijm_, d1aijs_, d1aijt1, d1aijt2
    complexed with bcl, bph, fe2, lda, u10

Details for d1aijr_

PDB Entry: 1aij (more details), 2.2 Å

PDB Description: photosynthetic reaction center from rhodobacter sphaeroides in the charge-neutral dqaqb state
PDB Compounds: (R:) photosynthetic reaction center (l subunit)

SCOPe Domain Sequences for d1aijr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aijr_ f.26.1.1 (R:) L (light) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

SCOPe Domain Coordinates for d1aijr_:

Click to download the PDB-style file with coordinates for d1aijr_.
(The format of our PDB-style files is described here.)

Timeline for d1aijr_: