SCOP 1.61: Domain d1aijm1: 1aij M:

Lineage for d1aijm1 (1aij M:)

1. Root: SCOP 1.61

2. Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)

3. Fold f.2: Membrane all-alpha [56868] (1 superfamily)

4. Superfamily f.2.1: Membrane all-alpha [56869] (13 families)

5. Family f.2.1.2: Photosynthetic reaction centre, L-, M- and H-chains [56878] (1 protein)

6. Protein Photosynthetic reaction centre, L-, M- and H-chains [56879] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [56881] (28 PDB entries)

8. Domain d1aijm1: 1aij M: [43462]
   Other proteins in same PDB: d1aijh1, d1aijt1

Details for d1aijm1

PDB Entry: 1aij, 2.2 Å

PDB Description: photosynthetic reaction center from rhodobacter sphaeroides in the charge-neutral dqaqb state

SCOP Domain Sequences for d1aijm1:

Sequence; same for both SEQRES and ATOM records:

>d1aijm1 f.2.1.2 (M:) Photosynthetic reaction centre, L-, M- and H-chains {Rhodobacter sphaeroides}
aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
h

Timeline for d1aijm1:

• d1aijm1 first appeared (with stable ids) in SCOP 1.55
  
• d1aijm1 appears in SCOP 1.59
  
• d1aijm1 is called d1aijm_ in SCOP 1.63
  
• d1aijm1 appears in the current release, SCOPe 2.08, called d1aijm_