| Class f: Membrane and cell surface proteins and peptides [56835] (34 folds) |
| Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) ![]() |
| Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (2 proteins) L and M are probably related to each other |
| Protein L (light) subunit [81477] (3 species) |
| Species Rhodobacter sphaeroides [TaxId:1063] [81475] (29 PDB entries) |
| Domain d1aijl_: 1aij L: [43461] Other proteins in same PDB: d1aijh1, d1aijh2, d1aijm_, d1aijs_, d1aijt1, d1aijt2 |
PDB Entry: 1aij (more details), 2.2 Å
SCOP Domain Sequences for d1aijl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aijl_ f.26.1.1 (L:) L (light) subunit {Rhodobacter sphaeroides}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging
Timeline for d1aijl_: