SCOP 1.63: Domain d1e6dl_: 1e6d L:

Lineage for d1e6dl_ (1e6d L:)

1. Root: SCOP 1.63

2. Class f: Membrane and cell surface proteins and peptides [56835] (34 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (2 proteins)
   L and M are probably related to each other

6. Protein L (light) subunit [81477] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81475] (29 PDB entries)

8. Domain d1e6dl_: 1e6d L: [43458]
   Other proteins in same PDB: d1e6dh1, d1e6dh2, d1e6dm_
   complexed with bcl, bph, fe, lda, po4, spn, u10; mutant

Details for d1e6dl_

PDB Entry: 1e6d, 2.3 Å

PDB Description: photosynthetic reaction center mutant with trp m115 replaced with phe (chain m, wm115f) phe m197 replaced with arg (chain m, fm197r)

SCOP Domain Sequences for d1e6dl_:

Sequence; same for both SEQRES and ATOM records:

>d1e6dl_ f.26.1.1 (L:) L (light) subunit {Rhodobacter sphaeroides}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

Timeline for d1e6dl_:

• d1e6dl_ first appeared (with stable ids) in SCOP 1.55, called d1e6dl1
  
• d1e6dl_ was called d1e6dl1 in SCOP 1.61
  
• d1e6dl_ appears in SCOP 1.65
  
• d1e6dl_ appears in the current release, SCOPe 2.08