Lineage for d1qovm_ (1qov M:)

  1. Root: SCOP 1.65
  2. 340091Class f: Membrane and cell surface proteins and peptides [56835] (36 folds)
  3. 341077Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 341078Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
  5. 341079Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (2 proteins)
    L and M are probably related to each other
  6. 341128Protein M (medium) subunit [81481] (3 species)
  7. 341129Species Rhodobacter sphaeroides [TaxId:1063] [81479] (29 PDB entries)
  8. 341130Domain d1qovm_: 1qov M: [43456]
    Other proteins in same PDB: d1qovh1, d1qovh2, d1qovl_

Details for d1qovm_

PDB Entry: 1qov (more details), 2.1 Å

PDB Description: photosynthetic reaction center mutant with ala m260 replaced with trp (chain m, a260w)

SCOP Domain Sequences for d1qovm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qovm_ f.26.1.1 (M:) M (medium) subunit {Rhodobacter sphaeroides}
aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
rgtaaeraalfwrwtmgfnwtmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
hg

SCOP Domain Coordinates for d1qovm_:

Click to download the PDB-style file with coordinates for d1qovm_.
(The format of our PDB-style files is described here.)

Timeline for d1qovm_: