SCOP 1.63: Domain d1qovl_: 1qov L:

Lineage for d1qovl_ (1qov L:)

1. Root: SCOP 1.63

2. Class f: Membrane and cell surface proteins and peptides [56835] (34 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (2 proteins)
   L and M are probably related to each other

6. Protein L (light) subunit [81477] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81475] (29 PDB entries)

8. Domain d1qovl_: 1qov L: [43455]
   Other proteins in same PDB: d1qovh1, d1qovh2, d1qovm_

Details for d1qovl_

PDB Entry: 1qov, 2.1 Å

PDB Description: photosynthetic reaction center mutant with ala m260 replaced with trp (chain m, a260w)

SCOP Domain Sequences for d1qovl_:

Sequence; same for both SEQRES and ATOM records:

>d1qovl_ f.26.1.1 (L:) L (light) subunit {Rhodobacter sphaeroides}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

Timeline for d1qovl_:

• d1qovl_ first appeared (with stable ids) in SCOP 1.55, called d1qovl1
  
• d1qovl_ was called d1qovl1 in SCOP 1.61
  
• d1qovl_ appears in SCOP 1.65
  
• d1qovl_ appears in the current release, SCOPe 2.08