| Class f: Membrane and cell surface proteins and peptides [56835] (34 folds) |
| Fold f.23: Single transmembrane helix [81407] (22 superfamilies) not a true fold |
Superfamily f.23.10: Photosystem II reaction centre subunit H, transmembrane region [81490] (1 family) ![]() |
| Family f.23.10.1: Photosystem II reaction centre subunit H, transmembrane region [81489] (1 protein) |
| Protein Photosystem II reaction centre subunit H, transmembrane region [81488] (3 species) |
| Species Rhodopseudomonas viridis [TaxId:1079] [81485] (8 PDB entries) |
| Domain d7prch2: 7prc H:1-36 [43454] Other proteins in same PDB: d7prcc_, d7prch1, d7prcl_, d7prcm_ complexed with 7mq, bcb, bpb, cet, fe2, hem, lda, ns5, so4 |
PDB Entry: 7prc (more details), 2.65 Å
SCOP Domain Sequences for d7prch2:
Sequence; same for both SEQRES and ATOM records: (download)
>d7prch2 f.23.10.1 (H:1-36) Photosystem II reaction centre subunit H, transmembrane region {Rhodopseudomonas viridis}
myhgalaqhldiaqlvwyaqwlviwtvvllylrred
Timeline for d7prch2: