![]() | Class f: Membrane and cell surface proteins and peptides [56835] (12 folds) |
![]() | Fold f.2: Membrane all-alpha [56868] (1 superfamily) |
![]() | Superfamily f.2.1: Membrane all-alpha [56869] (11 families) ![]() |
![]() | Family f.2.1.2: Photosynthetic reaction centre, L-, M- and H-chains [56878] (1 protein) |
![]() | Protein Photosynthetic reaction centre, L-, M- and H-chains [56879] (3 species) |
![]() | Species Rhodopseudomonas viridis [TaxId:1079] [56880] (8 PDB entries) |
![]() | Domain d7prcm1: 7prc M: [43453] Other proteins in same PDB: d7prcc_, d7prch1 |
PDB Entry: 7prc (more details), 2.65 Å
SCOP Domain Sequences for d7prcm1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7prcm1 f.2.1.2 (M:) Photosynthetic reaction centre, L-, M- and H-chains {Rhodopseudomonas viridis} adyqtiytqiqargphitvsgewgdndrvgkpfysywlgkigdaqigpiylgasgiaafa fgstailiilfnmaaevhfdplqffrqffwlglyppkaqygmgipplhdggwwlmaglfm tlslgswwirvysraralglgthiawnfaaaiffvlcigcihptlvgswsegvpfgiwph idwltafsirygnfyycpwhgfsigfaygcgllfaahgatilavarfggdreieqitdrg taveraalfwrwtigfnatiesvhrwgwffslmvmvsasvgilltgtfvdnwylwcvkhg aapdypaylpatpdpaslpgapk
Timeline for d7prcm1:
![]() Domains from other chains: (mouse over for more information) d7prcc_, d7prch1, d7prch2, d7prcl1 |