| Class f: Membrane and cell surface proteins and peptides [56835] (34 folds) |
| Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) ![]() |
| Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (2 proteins) L and M are probably related to each other |
| Protein L (light) subunit [81477] (3 species) |
| Species Rhodopseudomonas viridis [TaxId:1079] [81474] (8 PDB entries) |
| Domain d7prcl_: 7prc L: [43452] Other proteins in same PDB: d7prcc_, d7prch1, d7prch2, d7prcm_ complexed with 7mq, bcb, bpb, cet, fe2, hem, lda, ns5, so4 |
PDB Entry: 7prc (more details), 2.65 Å
SCOP Domain Sequences for d7prcl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7prcl_ f.26.1.1 (L:) L (light) subunit {Rhodopseudomonas viridis}
allsferkyrvrggtliggdlfdfwvgpyfvgffgvsaiffiflgvsligyaasqgptwd
pfaisinppdlkyglgaaplleggfwqaitvcalgafiswmlreveisrklgigwhvpla
fcvpifmfcvlqvfrplllgswghafpygilshldwvnnfgyqylnwhynpghmssvsfl
fvnamalglhgglilsvanpgdgdkvktaehenqyfrdvvgysigalsihrlglflasni
fltgafgtiasgpfwtrgwpewwgwwldipfws
Timeline for d7prcl_:
View in 3DDomains from other chains: (mouse over for more information) d7prcc_, d7prch1, d7prch2, d7prcm_ |