Lineage for d4prcm_ (4prc M:)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 887887Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 887888Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
  5. 887889Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (4 proteins)
    L and M are probably related to each other
  6. 887981Protein M (medium) subunit [81481] (3 species)
  7. 888056Species Rhodopseudomonas viridis [TaxId:1079] [81478] (11 PDB entries)
  8. 888063Domain d4prcm_: 4prc M: [43450]
    Other proteins in same PDB: d4prcc_, d4prch1, d4prch2, d4prcl_
    complexed with 7mq, bcb, bpb, fe2, hem, lda, ns5, sma, so4

Details for d4prcm_

PDB Entry: 4prc (more details), 2.4 Å

PDB Description: photosynthetic reaction center from rhodopseudomonas viridis (stigmatellin complex)
PDB Compounds: (M:) photosynthetic reaction center

SCOP Domain Sequences for d4prcm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4prcm_ f.26.1.1 (M:) M (medium) subunit {Rhodopseudomonas viridis [TaxId: 1079]}
adyqtiytqiqargphitvsgewgdndrvgkpfysywlgkigdaqigpiylgasgiaafa
fgstailiilfnmaaevhfdplqffrqffwlglyppkaqygmgipplhdggwwlmaglfm
tlslgswwirvysraralglgthiawnfaaaiffvlcigcihptlvgswsegvpfgiwph
idwltafsirygnfyycpwhgfsigfaygcgllfaahgatilavarfggdreieqitdrg
taveraalfwrwtigfnatiesvhrwgwffslmvmvsasvgilltgtfvdnwylwcvkhg
aapdypaylpatpdpaslpgapk

SCOP Domain Coordinates for d4prcm_:

Click to download the PDB-style file with coordinates for d4prcm_.
(The format of our PDB-style files is described here.)

Timeline for d4prcm_:

  • d4prcm_ first appeared (with stable ids) in SCOP 1.55, called d4prcm1
  • d4prcm_ appears in SCOP 1.73
  • d4prcm_ does not appear in SCOPe 2.01