![]() | Class f: Membrane and cell surface proteins and peptides [56835] (58 folds) |
![]() | Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
![]() | Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) ![]() |
![]() | Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (4 proteins) L and M are probably related to each other |
![]() | Protein M (medium) subunit [81481] (3 species) |
![]() | Species Rhodopseudomonas viridis [TaxId:1079] [81478] (11 PDB entries) |
![]() | Domain d4prcm_: 4prc M: [43450] Other proteins in same PDB: d4prcc_, d4prch1, d4prch2, d4prcl_ complexed with 7mq, bcb, bpb, fe2, hem, lda, ns5, sma, so4 |
PDB Entry: 4prc (more details), 2.4 Å
SCOP Domain Sequences for d4prcm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4prcm_ f.26.1.1 (M:) M (medium) subunit {Rhodopseudomonas viridis [TaxId: 1079]} adyqtiytqiqargphitvsgewgdndrvgkpfysywlgkigdaqigpiylgasgiaafa fgstailiilfnmaaevhfdplqffrqffwlglyppkaqygmgipplhdggwwlmaglfm tlslgswwirvysraralglgthiawnfaaaiffvlcigcihptlvgswsegvpfgiwph idwltafsirygnfyycpwhgfsigfaygcgllfaahgatilavarfggdreieqitdrg taveraalfwrwtigfnatiesvhrwgwffslmvmvsasvgilltgtfvdnwylwcvkhg aapdypaylpatpdpaslpgapk
Timeline for d4prcm_:
![]() Domains from other chains: (mouse over for more information) d4prcc_, d4prch1, d4prch2, d4prcl_ |