SCOP 1.63: Domain d4prcm_: 4prc M:

Lineage for d4prcm_ (4prc M:)

1. Root: SCOP 1.63

2. Class f: Membrane and cell surface proteins and peptides [56835] (34 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (2 proteins)
   L and M are probably related to each other

6. Protein M (medium) subunit [81481] (3 species)

7. Species Rhodopseudomonas viridis [TaxId:1079] [81478] (8 PDB entries)

8. Domain d4prcm_: 4prc M: [43450]
   Other proteins in same PDB: d4prcc_, d4prch1, d4prch2, d4prcl_
   complexed with 7mq, bcb, bpb, fe2, hem, lda, ns5, sma, so4

Details for d4prcm_

PDB Entry: 4prc, 2.4 Å

PDB Description: photosynthetic reaction center from rhodopseudomonas viridis (stigmatellin complex)

SCOP Domain Sequences for d4prcm_:

Sequence; same for both SEQRES and ATOM records:

>d4prcm_ f.26.1.1 (M:) M (medium) subunit {Rhodopseudomonas viridis}
adyqtiytqiqargphitvsgewgdndrvgkpfysywlgkigdaqigpiylgasgiaafa
fgstailiilfnmaaevhfdplqffrqffwlglyppkaqygmgipplhdggwwlmaglfm
tlslgswwirvysraralglgthiawnfaaaiffvlcigcihptlvgswsegvpfgiwph
idwltafsirygnfyycpwhgfsigfaygcgllfaahgatilavarfggdreieqitdrg
taveraalfwrwtigfnatiesvhrwgwffslmvmvsasvgilltgtfvdnwylwcvkhg
aapdypaylpatpdpaslpgapk

Timeline for d4prcm_:

• d4prcm_ first appeared (with stable ids) in SCOP 1.55, called d4prcm1
  
• d4prcm_ was called d4prcm1 in SCOP 1.61
  
• d4prcm_ appears in SCOP 1.65
  
• d4prcm_ last appears in SCOP 1.75