SCOP 1.61: Domain d4prcm1: 4prc M:

Lineage for d4prcm1 (4prc M:)

1. Root: SCOP 1.61

2. Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)

3. Fold f.2: Membrane all-alpha [56868] (1 superfamily)

4. Superfamily f.2.1: Membrane all-alpha [56869] (13 families)

5. Family f.2.1.2: Photosynthetic reaction centre, L-, M- and H-chains [56878] (1 protein)

6. Protein Photosynthetic reaction centre, L-, M- and H-chains [56879] (3 species)

7. Species Rhodopseudomonas viridis [TaxId:1079] [56880] (8 PDB entries)

8. Domain d4prcm1: 4prc M: [43450]
   Other proteins in same PDB: d4prcc_, d4prch1

Details for d4prcm1

PDB Entry: 4prc, 2.4 Å

PDB Description: photosynthetic reaction center from rhodopseudomonas viridis (stigmatellin complex)

SCOP Domain Sequences for d4prcm1:

Sequence; same for both SEQRES and ATOM records:

>d4prcm1 f.2.1.2 (M:) Photosynthetic reaction centre, L-, M- and H-chains {Rhodopseudomonas viridis}
adyqtiytqiqargphitvsgewgdndrvgkpfysywlgkigdaqigpiylgasgiaafa
fgstailiilfnmaaevhfdplqffrqffwlglyppkaqygmgipplhdggwwlmaglfm
tlslgswwirvysraralglgthiawnfaaaiffvlcigcihptlvgswsegvpfgiwph
idwltafsirygnfyycpwhgfsigfaygcgllfaahgatilavarfggdreieqitdrg
taveraalfwrwtigfnatiesvhrwgwffslmvmvsasvgilltgtfvdnwylwcvkhg
aapdypaylpatpdpaslpgapk

Timeline for d4prcm1:

• d4prcm1 first appeared (with stable ids) in SCOP 1.55
  
• d4prcm1 appears in SCOP 1.59
  
• d4prcm1 is called d4prcm_ in SCOP 1.63
  
• d4prcm1 last appears in SCOP 1.75, called d4prcm_