![]() | Class f: Membrane and cell surface proteins and peptides [56835] (11 folds) |
![]() | Fold f.2: Membrane all-alpha [56868] (1 superfamily) |
![]() | Superfamily f.2.1: Membrane all-alpha [56869] (10 families) ![]() |
![]() | Family f.2.1.2: Photosynthetic reaction centre, L-, M- and H-chains [56878] (1 protein) |
![]() | Protein Photosynthetic reaction centre, L-, M- and H-chains [56879] (3 species) |
![]() | Species Rhodopseudomonas viridis [TaxId:1079] [56880] (8 PDB entries) |
![]() | Domain d4prcm1: 4prc M: [43450] Other proteins in same PDB: d4prcc_, d4prch1 |
PDB Entry: 4prc (more details), 2.4 Å
SCOP Domain Sequences for d4prcm1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4prcm1 f.2.1.2 (M:) Photosynthetic reaction centre, L-, M- and H-chains {Rhodopseudomonas viridis} adyqtiytqiqargphitvsgewgdndrvgkpfysywlgkigdaqigpiylgasgiaafa fgstailiilfnmaaevhfdplqffrqffwlglyppkaqygmgipplhdggwwlmaglfm tlslgswwirvysraralglgthiawnfaaaiffvlcigcihptlvgswsegvpfgiwph idwltafsirygnfyycpwhgfsigfaygcgllfaahgatilavarfggdreieqitdrg taveraalfwrwtigfnatiesvhrwgwffslmvmvsasvgilltgtfvdnwylwcvkhg aapdypaylpatpdpaslpgapk
Timeline for d4prcm1:
![]() Domains from other chains: (mouse over for more information) d4prcc_, d4prch1, d4prch2, d4prcl1 |