| Class f: Membrane and cell surface proteins and peptides [56835] (34 folds) |
| Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) ![]() |
| Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (2 proteins) L and M are probably related to each other |
| Protein L (light) subunit [81477] (3 species) |
| Species Rhodopseudomonas viridis [TaxId:1079] [81474] (8 PDB entries) |
| Domain d4prcl_: 4prc L: [43449] Other proteins in same PDB: d4prcc_, d4prch1, d4prch2, d4prcm_ complexed with 7mq, bcb, bpb, fe2, hem, lda, ns5, sma, so4 |
PDB Entry: 4prc (more details), 2.4 Å
SCOP Domain Sequences for d4prcl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4prcl_ f.26.1.1 (L:) L (light) subunit {Rhodopseudomonas viridis}
allsferkyrvrggtliggdlfdfwvgpyfvgffgvsaiffiflgvsligyaasqgptwd
pfaisinppdlkyglgaaplleggfwqaitvcalgafiswmlreveisrklgigwhvpla
fcvpifmfcvlqvfrplllgswghafpygilshldwvnnfgyqylnwhynpghmssvsfl
fvnamalglhgglilsvanpgdgdkvktaehenqyfrdvvgysigalsihrlglflasni
fltgafgtiasgpfwtrgwpewwgwwldipfws
Timeline for d4prcl_:
View in 3DDomains from other chains: (mouse over for more information) d4prcc_, d4prch1, d4prch2, d4prcm_ |