SCOP 1.63: Domain d2prcm_: 2prc M:

Lineage for d2prcm_ (2prc M:)

1. Root: SCOP 1.63

2. Class f: Membrane and cell surface proteins and peptides [56835] (34 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (2 proteins)
   L and M are probably related to each other

6. Protein M (medium) subunit [81481] (3 species)

7. Species Rhodopseudomonas viridis [TaxId:1079] [81478] (8 PDB entries)

8. Domain d2prcm_: 2prc M: [43447]
   Other proteins in same PDB: d2prcc_, d2prch1, d2prch2, d2prcl_
   complexed with 7mq, bcb, bpb, fe2, hem, lda, ns5, so4, uq2

Details for d2prcm_

PDB Entry: 2prc, 2.45 Å

PDB Description: photosynthetic reaction center from rhodopseudomonas viridis (ubiquinone-2 complex)

SCOP Domain Sequences for d2prcm_:

Sequence; same for both SEQRES and ATOM records:

>d2prcm_ f.26.1.1 (M:) M (medium) subunit {Rhodopseudomonas viridis}
adyqtiytqiqargphitvsgewgdndrvgkpfysywlgkigdaqigpiylgasgiaafa
fgstailiilfnmaaevhfdplqffrqffwlglyppkaqygmgipplhdggwwlmaglfm
tlslgswwirvysraralglgthiawnfaaaiffvlcigcihptlvgswsegvpfgiwph
idwltafsirygnfyycpwhgfsigfaygcgllfaahgatilavarfggdreieqitdrg
taveraalfwrwtigfnatiesvhrwgwffslmvmvsasvgilltgtfvdnwylwcvkhg
aapdypaylpatpdpaslpgapk

Timeline for d2prcm_:

• d2prcm_ first appeared (with stable ids) in SCOP 1.55, called d2prcm1
  
• d2prcm_ was called d2prcm1 in SCOP 1.61
  
• d2prcm_ appears in SCOP 1.65
  
• d2prcm_ appears in the current release, SCOPe 2.08