| Class f: Membrane and cell surface proteins and peptides [56835] (34 folds) |
| Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) ![]() |
| Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (2 proteins) L and M are probably related to each other |
| Protein M (medium) subunit [81481] (3 species) |
| Species Rhodopseudomonas viridis [TaxId:1079] [81478] (8 PDB entries) |
| Domain d2prcm_: 2prc M: [43447] Other proteins in same PDB: d2prcc_, d2prch1, d2prch2, d2prcl_ complexed with 7mq, bcb, bpb, fe2, hem, lda, ns5, so4, uq2 |
PDB Entry: 2prc (more details), 2.45 Å
SCOP Domain Sequences for d2prcm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2prcm_ f.26.1.1 (M:) M (medium) subunit {Rhodopseudomonas viridis}
adyqtiytqiqargphitvsgewgdndrvgkpfysywlgkigdaqigpiylgasgiaafa
fgstailiilfnmaaevhfdplqffrqffwlglyppkaqygmgipplhdggwwlmaglfm
tlslgswwirvysraralglgthiawnfaaaiffvlcigcihptlvgswsegvpfgiwph
idwltafsirygnfyycpwhgfsigfaygcgllfaahgatilavarfggdreieqitdrg
taveraalfwrwtigfnatiesvhrwgwffslmvmvsasvgilltgtfvdnwylwcvkhg
aapdypaylpatpdpaslpgapk
Timeline for d2prcm_:
View in 3DDomains from other chains: (mouse over for more information) d2prcc_, d2prch1, d2prch2, d2prcl_ |