Lineage for d2prcm1 (2prc M:)

  1. Root: SCOP 1.59
  2. 141686Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)
  3. 141752Fold f.2: Membrane all-alpha [56868] (1 superfamily)
  4. 141753Superfamily f.2.1: Membrane all-alpha [56869] (11 families) (S)
  5. 141805Family f.2.1.2: Photosynthetic reaction centre, L-, M- and H-chains [56878] (1 protein)
  6. 141806Protein Photosynthetic reaction centre, L-, M- and H-chains [56879] (3 species)
  7. 141892Species Rhodopseudomonas viridis [TaxId:1079] [56880] (8 PDB entries)
  8. 141910Domain d2prcm1: 2prc M: [43447]
    Other proteins in same PDB: d2prcc_, d2prch1

Details for d2prcm1

PDB Entry: 2prc (more details), 2.45 Å

PDB Description: photosynthetic reaction center from rhodopseudomonas viridis (ubiquinone-2 complex)

SCOP Domain Sequences for d2prcm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2prcm1 f.2.1.2 (M:) Photosynthetic reaction centre, L-, M- and H-chains {Rhodopseudomonas viridis}
adyqtiytqiqargphitvsgewgdndrvgkpfysywlgkigdaqigpiylgasgiaafa
fgstailiilfnmaaevhfdplqffrqffwlglyppkaqygmgipplhdggwwlmaglfm
tlslgswwirvysraralglgthiawnfaaaiffvlcigcihptlvgswsegvpfgiwph
idwltafsirygnfyycpwhgfsigfaygcgllfaahgatilavarfggdreieqitdrg
taveraalfwrwtigfnatiesvhrwgwffslmvmvsasvgilltgtfvdnwylwcvkhg
aapdypaylpatpdpaslpgapk

SCOP Domain Coordinates for d2prcm1:

Click to download the PDB-style file with coordinates for d2prcm1.
(The format of our PDB-style files is described here.)

Timeline for d2prcm1: