Class f: Membrane and cell surface proteins and peptides [56835] (12 folds) |
Fold f.2: Membrane all-alpha [56868] (1 superfamily) |
Superfamily f.2.1: Membrane all-alpha [56869] (11 families) |
Family f.2.1.2: Photosynthetic reaction centre, L-, M- and H-chains [56878] (1 protein) |
Protein Photosynthetic reaction centre, L-, M- and H-chains [56879] (3 species) |
Species Rhodopseudomonas viridis [TaxId:1079] [56880] (8 PDB entries) |
Domain d2prcm1: 2prc M: [43447] Other proteins in same PDB: d2prcc_, d2prch1 |
PDB Entry: 2prc (more details), 2.45 Å
SCOP Domain Sequences for d2prcm1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2prcm1 f.2.1.2 (M:) Photosynthetic reaction centre, L-, M- and H-chains {Rhodopseudomonas viridis} adyqtiytqiqargphitvsgewgdndrvgkpfysywlgkigdaqigpiylgasgiaafa fgstailiilfnmaaevhfdplqffrqffwlglyppkaqygmgipplhdggwwlmaglfm tlslgswwirvysraralglgthiawnfaaaiffvlcigcihptlvgswsegvpfgiwph idwltafsirygnfyycpwhgfsigfaygcgllfaahgatilavarfggdreieqitdrg taveraalfwrwtigfnatiesvhrwgwffslmvmvsasvgilltgtfvdnwylwcvkhg aapdypaylpatpdpaslpgapk
Timeline for d2prcm1:
View in 3D Domains from other chains: (mouse over for more information) d2prcc_, d2prch1, d2prch2, d2prcl1 |