Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)
Search SCOP (example):

Lineage for d2prcm_ (2prc M:)

  1. Root: SCOP 1.75B
  2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
  5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 protein domains)
    L and M are probably related to each other
  6. Protein M (medium) subunit [81481] (3 species)
  7. Species Rhodopseudomonas viridis [TaxId:1079] [81478] (10 PDB entries)
  8. Domain d2prcm_: 2prc M: [43447]
    Other proteins in same PDB: d2prcc_, d2prch1, d2prch2, d2prcl_
    complexed with bcb, bpb, fe2, hem, lda, mq7, ns5, so4, uq2

Details for d2prcm_

PDB Entry: 2prc (more details)
PDB Description: photosynthetic reaction center from rhodopseudomonas viridis (ubiquinone-2 complex)
PDB Compounds: (M:) photosynthetic reaction center

SCOP Domain Sequences for d2prcm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2prcm_ f.26.1.1 (M:) M (medium) subunit {Rhodopseudomonas viridis [TaxId: 1079]}
adyqtiytqiqargphitvsgewgdndrvgkpfysywlgkigdaqigpiylgasgiaafa
fgstailiilfnmaaevhfdplqffrqffwlglyppkaqygmgipplhdggwwlmaglfm
tlslgswwirvysraralglgthiawnfaaaiffvlcigcihptlvgswsegvpfgiwph
idwltafsirygnfyycpwhgfsigfaygcgllfaahgatilavarfggdreieqitdrg
taveraalfwrwtigfnatiesvhrwgwffslmvmvsasvgilltgtfvdnwylwcvkhg
aapdypaylpatpdpaslpgapk

SCOP Domain Coordinates for d2prcm_:

Click to download the PDB-style file with coordinates for d2prcm_.
(The format of our PDB-style files is described here.)

Timeline for d2prcm_:

d2prcm_ appears in SCOP 1.75A


d2prcm_
(click for larger image)


d2prcm_ in context of chain



d2prcm_ in context of PDB
Domains from other chains:
d2prcc_, d2prch1, d2prch2, d2prcl_

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu