SCOP 1.55: Domain d2prcl1: 2prc L:

Lineage for d2prcl1 (2prc L:)

1. Root: SCOP 1.55

2. Class f: Membrane and cell surface proteins and peptides [56835] (11 folds)

3. Fold f.2: Membrane all-alpha [56868] (1 superfamily)

4. Superfamily f.2.1: Membrane all-alpha [56869] (10 families)

5. Family f.2.1.2: Photosynthetic reaction centre, L-, M- and H-chains [56878] (1 protein)

6. Protein Photosynthetic reaction centre, L-, M- and H-chains [56879] (3 species)

7. Species Rhodopseudomonas viridis [TaxId:1079] [56880] (8 PDB entries)

8. Domain d2prcl1: 2prc L: [43446]
   Other proteins in same PDB: d2prcc_, d2prch1

Details for d2prcl1

PDB Entry: 2prc, 2.45 Å

PDB Description: photosynthetic reaction center from rhodopseudomonas viridis (ubiquinone-2 complex)

SCOP Domain Sequences for d2prcl1:

Sequence; same for both SEQRES and ATOM records:

>d2prcl1 f.2.1.2 (L:) Photosynthetic reaction centre, L-, M- and H-chains {Rhodopseudomonas viridis}
allsferkyrvrggtliggdlfdfwvgpyfvgffgvsaiffiflgvsligyaasqgptwd
pfaisinppdlkyglgaaplleggfwqaitvcalgafiswmlreveisrklgigwhvpla
fcvpifmfcvlqvfrplllgswghafpygilshldwvnnfgyqylnwhynpghmssvsfl
fvnamalglhgglilsvanpgdgdkvktaehenqyfrdvvgysigalsihrlglflasni
fltgafgtiasgpfwtrgwpewwgwwldipfws

Timeline for d2prcl1:

• d2prcl1 appears in SCOP 1.57
  
• d2prcl1 appears in the current release, SCOPe 2.08, called d2prcl_