| Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
| Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) ![]() automatically mapped to Pfam PF00124 |
| Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins) L and M are probably related to each other |
| Protein L (light) subunit [81477] (4 species) |
| Species Rhodopseudomonas viridis [TaxId:1079] [81474] (21 PDB entries) |
| Domain d2prcl_: 2prc L: [43446] Other proteins in same PDB: d2prcc_, d2prch1, d2prch2, d2prch3, d2prcm_ complexed with bcb, bpb, fe2, hem, lda, mq7, ns5, so4, uq2 |
PDB Entry: 2prc (more details), 2.45 Å
SCOPe Domain Sequences for d2prcl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2prcl_ f.26.1.1 (L:) L (light) subunit {Rhodopseudomonas viridis [TaxId: 1079]}
allsferkyrvrggtliggdlfdfwvgpyfvgffgvsaiffiflgvsligyaasqgptwd
pfaisinppdlkyglgaaplleggfwqaitvcalgafiswmlreveisrklgigwhvpla
fcvpifmfcvlqvfrplllgswghafpygilshldwvnnfgyqylnwhynpghmssvsfl
fvnamalglhgglilsvanpgdgdkvktaehenqyfrdvvgysigalsihrlglflasni
fltgafgtiasgpfwtrgwpewwgwwldipfws
Timeline for d2prcl_: